PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_2DS_D0563916C.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family bZIP
Protein Properties Length: 50aa    MW: 5752.58 Da    PI: 11.7781
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_2DS_D0563916C.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_136.98.1e-124411350
                           HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                 bZIP_1 13 NReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50
                           NR +A+rsR RK+++i eLe+ v +L++e +aL  ++ 
  Traes_2DS_D0563916C.1  4 NRQSAQRSRVRKLQYISELERSVTSLQTEVSALSPRVA 41
                           *****************************999987665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd147033.15E-15147No hitNo description
PROSITE profilePS502178.634150IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.44E-11247No hitNo description
Gene3DG3DSA:1.20.5.1707.6E-14348No hitNo description
PfamPF001709.6E-10345IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 50 aa     Download sequence    Send to blast
ILANRQSAQR SRVRKLQYIS ELERSVTSLQ TEVSALSPRV AFLDHQRSLL
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0368212e-61BT036821.1 Zea mays full-length cDNA clone ZM_BFb0141B19 mRNA, complete cds.
GenBankBT0612662e-61BT061266.1 Zea mays full-length cDNA clone ZM_BFb0128B20 mRNA, complete cds.
GenBankKJ7275572e-61KJ727557.1 Zea mays clone pUT5417 bZIP transcription factor (bZIP117) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002454954.18e-26hypothetical protein SORBIDRAFT_03g002050
RefseqXP_004968609.18e-26PREDICTED: basic leucine zipper 2-like
RefseqXP_014753813.19e-26PREDICTED: basic leucine zipper 2-like
RefseqXP_015694867.17e-26PREDICTED: basic leucine zipper 2-like
SwissprotQ5QNI51e-27BZP02_ORYSJ; Basic leucine zipper 2
TrEMBLW5C8M93e-27W5C8M9_WHEAT; Uncharacterized protein
STRINGBRADI2G06790.11e-25(Brachypodium distachyon)
STRINGLOC_Os01g11350.13e-25(Oryza sativa Japonica Group)
STRINGSi002311m3e-25(Setaria italica)
STRINGSb03g002050.12e-25(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP1779279
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G58120.12e-26bZIP family protein
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]